IGF-1 LR3 1 mg
$100.00
Research-grade IGF-1 LR3, 1 mg per vial. Lyophilized powder, HPLC-tested at >99% by Janoshik Analytical โ an independent third-party laboratory. Ships same business day from the United States on orders placed by 2 PM CT. For laboratory research use only โ not for human or veterinary use.
| Quantity | Discount | Discounted price |
| 3 - 4 | 10% | $90.00 |
| 5 - 9 | 15% | $85.00 |
| 10 + | 20% | $80.00 |
Description
Overview
IGF-1 LR3 (Long R3 IGF-1) is an 83-amino-acid analog of insulin-like growth factor 1 with an N-terminal 13-residue extension and an Arg substitution at position 3. The structural modifications reduce IGFBP binding and extend half-life, making it a widely used research tool in growth, metabolic, and cellular-proliferation studies.
Key: [JANOSHIK_KEY]
Research applications
- IGF-1 receptor signaling research
- Cellular proliferation and differentiation studies
- Skeletal-muscle and growth-pathway investigation
- Comparative IGFBP-binding studies
Specifications
| CAS Number | 946870-92-4 |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Molecular Weight | 9111.34 g/mol |
| Purity | ≥99% (HPLC) |
| Container | 1 mg lyophilized, sterile vial |
| Appearance | White lyophilized powder |
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Storage & handling
Store sealed lyophilized vials at -20 °C for long-term storage, or 2–8 °C for short-term. Protect from light. Handling and storage instructions for laboratory personnel are provided on the Certificate of Analysis. For laboratory research use only — not for human or veterinary use.
Additional information
| Weight | 1 oz |
|---|
You may also like…
-

BPC-157
Price range: $55.00 through $62.00Select options This product has multiple variants. The options may be chosen on the product page -

BAC Water
Price range: $15.00 through $20.00Select options This product has multiple variants. The options may be chosen on the product page -

Product photos are representative. Actual packaging may vary by batch.






Reviews
There are no reviews yet.