IGF-1 LR3 1 mg
Original price was: $100.00.$85.00Current price is: $85.00.
Research-grade IGF-1 LR3, 1 mg per vial. Lyophilized powder, HPLC-tested at >99% by Janoshik Analytical — an independent third-party laboratory. Ships same business day from the United States on orders placed by 2 PM CT. For laboratory research use only — not for human or veterinary use.
| Quantity | Discount | Discounted price |
| 3 - 4 | 10% | $90.00 |
| 5 - 9 | 15% | $85.00 |
| 10 + | 20% | $80.00 |
Description
Overview
IGF-1 LR3 (Long R3 IGF-1) is an 83-amino-acid analog of insulin-like growth factor 1 with an N-terminal 13-residue extension and an Arg substitution at position 3. The structural modifications reduce IGFBP binding and extend half-life, making it a widely used research tool in growth, metabolic, and cellular-proliferation studies.
Key: [JANOSHIK_KEY]
Research applications
- IGF-1 receptor signaling research
- Cellular proliferation and differentiation studies
- Skeletal-muscle and growth-pathway investigation
- Comparative IGFBP-binding studies
Specifications
| CAS Number | 946870-92-4 |
| Molecular Formula | C₄₀₀H₆₂₅N₁₁₁O₁₁₅S₉ |
| Molecular Weight | 9111.34 g/mol |
| Purity | ≥99% (HPLC) |
| Container | 1 mg lyophilized, sterile vial |
| Appearance | White lyophilized powder |
Sequence
MFPAMPLSSLFVNGPRTLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA
Storage & handling
Store sealed lyophilized vials at -20 °C for long-term storage, or 2–8 °C for short-term. Protect from light. Handling and storage instructions for laboratory personnel are provided on the Certificate of Analysis. For laboratory research use only — not for human or veterinary use.
Additional information
| Weight | 1 oz |
|---|
You may also like…
-
BAC Water
Price range: $15.00 through $20.00Select options This product has multiple variants. The options may be chosen on the product page -
Sale!
CJC-1295 (No DAC) + Ipamorelin 5 mg / 5 mg
Original price was: $100.00.$85.00Current price is: $85.00. -
Sale!
BPC-157
Price range: $46.75 through $52.70Select options This product has multiple variants. The options may be chosen on the product page
Related products
-
Sale!
-
Sale!
-
Sale!
-
Sale!
Retatrutide
Price range: $76.50 through $212.50Select options This product has multiple variants. The options may be chosen on the product page
Product photos are representative. Actual packaging may vary by batch.
Reviews
There are no reviews yet.